HPA004716

KIF2A antibody from Atlas Antibodies
HK2, KIF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004716
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004716, RRID:AB_1079211
Product name
Anti-KIF2A
Provider product page
Atlas Antibodies - HPA004716
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPD
EEIEPSPETPPPPASSAKVNKIVKNRRTVASIKND
PPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDI
SPVQA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -