HPA004716

KIF2A antibody from Sigma-Aldrich
HK2, KIF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004716
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004716, RRID:AB_1079211
Product name
Anti-KIF2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004716
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPD
EEIEPSPETPPPPASSAKVNKIVKNRRTVASIKND
PPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDI
SPVQA
Storage
-20C
Provider Type Product Number
- No reagents -