HPA020582

TBRG4 antibody from Sigma-Aldrich
Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020582
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020582, RRID:AB_1857804
Product name
Anti-TBRG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020582
Antibody type
Polyclonal
Antigen
Protein TBRG4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKT
LTSSATSPISHLPGSLMEPVEKERASTPYIEKQVD
HLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLS
HLLSEKP
Storage
-20C
Provider Type Product Number
- No reagents -