Antibody data

Product number
HPA055387
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055387, RRID:AB_2682802
Product name
Anti-IER2
Provider product page
Atlas Antibodies - HPA055387
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -