Antibody data

Product number
H00009592-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009592-M05, RRID:AB_1679498
Product name
IER2 monoclonal antibody (M05), clone 3E2
Provider product page
Abnova Corporation - H00009592-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant IER2.
Antigen sequence
MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQ
LSLVMRSARELYLSAKVEALEPEVSLPAALPSDPR
LHPPREAESTAETATPDGEHPFPEPMDTQEAPTAE
ETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKK
ARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLA
RVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPAD
SMLNVLVRAVVAF
Isotype
IgG
Antibody clone number
3E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -