SAB1401485

IER2 antibody from MilliporeSigma / Merck KGaA
ETR101
ELISA
Recommended by provider

Antibody data

Product number
SAB1401485
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401485, RRID:AB_10611901
Product name
Monoclonal Anti-IER2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401485
Antibody type
Monoclonal
Antigen
IER2 (AAH03625, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQ
LSLVMRSARELYLSAKVEALEPEVSLPAALPSDPR
LHPPREAESTAETATPDGEHPFPEPMDTQEAPTAE
ETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKK
ARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLA
RVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPAD
SMLNVLVRAVVAF*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -