HPA004428

ACAT1 antibody from Atlas Antibodies
ACAT, THIL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004428
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004428, RRID:AB_887608
Product name
Anti-ACAT1
Provider product page
Atlas Antibodies - HPA004428
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKA
GIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLP
ISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMV
AGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGL
TD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -