HPA007569

ACAT1 antibody from Sigma-Aldrich
ACAT, THIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007569, RRID:AB_1844482
Product name
Anti-ACAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007569
Antibody type
Polyclonal
Antigen
Acetyl-CoA acetyltransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVK
GQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTV
TAANASTLNDGAAALVLMTADAAKRLNVTPLARIV
AFADAAVEPIDFPIAPVYAASMV
Storage
-20C
Provider Type Product Number
- No reagents -