Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034684 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA034684, RRID:AB_10669894
- Product name
- Anti-CCNG2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PSVLALCLLNLEVETLKSVELLEILLLVKKHSKIN
DTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIV
SRRTAQNLHNSYYSVPELPTIPEGGCFDESES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cyclin G2 regulates canonical Wnt signalling via interaction with Dapper1 to attenuate tubulointerstitial fibrosis in diabetic nephropathy
Cyclin G2 Inhibits Oral Squamous Cell Carcinoma Growth and Metastasis by Binding to IGFBP3 and Regulating the FAK-SRC-STAT Signaling Pathway
Cyclin G2 Inhibits the Warburg Effect and Tumour Progression by Suppressing LDHA Phosphorylation in Glioma
Zhao C, Gao J, Li S, Liu Q, Hou X, Xing X, Wang D, Sun M, Wang S, Luo Y
Journal of Cellular and Molecular Medicine 2020;24(5):2749-2760
Journal of Cellular and Molecular Medicine 2020;24(5):2749-2760
Cyclin G2 Inhibits Oral Squamous Cell Carcinoma Growth and Metastasis by Binding to IGFBP3 and Regulating the FAK-SRC-STAT Signaling Pathway
Wang D, Gao J, Zhao C, Li S, Zhang D, Hou X, Zhuang X, Liu Q, Luo Y
Frontiers in Oncology 2020;10
Frontiers in Oncology 2020;10
Cyclin G2 Inhibits the Warburg Effect and Tumour Progression by Suppressing LDHA Phosphorylation in Glioma
Li S, Gao J, Zhuang X, Zhao C, Hou X, Xing X, Chen C, Liu Q, Liu S, Luo Y
International Journal of Biological Sciences 2019;15(3):544-555
International Journal of Biological Sciences 2019;15(3):544-555
No comments: Submit comment
No validations: Submit validation data