Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184168 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cyclin G2 (CCNG2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCNG2 antibody: synthetic peptide directed towards the N terminal of human CCNG2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPRE
KGLSL IEATPENDNT- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cyclin G2 associates with protein phosphatase 2A catalytic and regulatory B' subunits in active complexes and induces nuclear aberrations and a G1/S phase cell cycle arrest.
Bennin DA, Don AS, Brake T, McKenzie JL, Rosenbaum H, Ortiz L, DePaoli-Roach AA, Horne MC
The Journal of biological chemistry 2002 Jul 26;277(30):27449-67
The Journal of biological chemistry 2002 Jul 26;277(30):27449-67
No comments: Submit comment
No validations: Submit validation data