HPA023606

GADD45G antibody from Sigma-Aldrich
CR6, DDIT2, GADD45gamma, GRP17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023606
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023606, RRID:AB_1849409
Product name
Anti-GADD45G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023606
Antibody type
Polyclonal
Antigen
Growth arrest and DNA-damage-inducible protein GADD45 gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQR
QGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIV
G
Storage
-20C
Provider Type Product Number
- No reagents -