HPA008874

FDFT1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008874
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008874, RRID:AB_1078844
Product name
Anti-FDFT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008874
Antibody type
Polyclonal
Antigen
Squalene synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCY
KYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRAL
DTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMES
KEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Storage
-20C
Provider Type Product Number
- No reagents -