HPA018499

USP4 antibody from Sigma-Aldrich
UNP, Unph
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018499, RRID:AB_1858689
Product name
Anti-USP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018499
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYE
VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALY
GQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLP
DEFGSSPL
Storage
-20C
Provider Type Product Number
- No reagents -