Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006728-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006728-D01P, RRID:AB_10719451
- Product name
- SRP19 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human SRP19 protein.
- Antigen sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRI
PISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSR
EWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVM
LYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKG
KKKK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SRP19 expression in transfected 293T cell line (H00006728-T02) by SRP19 MaxPab polyclonal antibody.Lane 1: SRP19 transfected lysate(16.20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to SRP19 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol