HPA018152

ARFGAP2 antibody from Sigma-Aldrich
FLJ14576, IRZ, Zfp289, ZNF289
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018152
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018152, RRID:AB_1844979
Product name
Anti-ARFGAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018152
Antibody type
Polyclonal
Antigen
ADP-ribosylation factor GTPase-activating protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRS
QLDLFDDVGTFASGPPKYKDNPFSLGESFGSRWDT
DAAWGMDRVEEKEPEVTISSIRPISERATNRREVE
SRSSGLESSEARQKFAGAKAISSD
Storage
-20C
Provider Type Product Number
- No reagents -