Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182883 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Afamin (AFM) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AFM antibody: synthetic peptide directed towards the middle region of human AFM
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDA
DPDTF FAKFTFEYSR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 2D-DIGE analysis of sera from transgenic mouse models reveals novel candidate protein biomarkers for human gastric cancer.
Afamin is a novel human vitamin E-binding glycoprotein characterization and in vitro expression.
Penno MA, Klingler-Hoffmann M, Brazzatti JA, Boussioutas A, Putoczki T, Ernst M, Hoffmann P
Journal of proteomics 2012 Dec 21;77:40-58
Journal of proteomics 2012 Dec 21;77:40-58
Afamin is a novel human vitamin E-binding glycoprotein characterization and in vitro expression.
Jerkovic L, Voegele AF, Chwatal S, Kronenberg F, Radcliffe CM, Wormald MR, Lobentanz EM, Ezeh B, Eller P, Dejori N, Dieplinger B, Lottspeich F, Sattler W, Uhr M, Mechtler K, Dwek RA, Rudd PM, Baier G, Dieplinger H
Journal of proteome research 2005 May-Jun;4(3):889-99
Journal of proteome research 2005 May-Jun;4(3):889-99
No comments: Submit comment
No validations: Submit validation data