HPA017006

AFM antibody from Sigma-Aldrich
ALB2, ALBA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017006
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017006, RRID:AB_1844635
Product name
Anti-AFM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017006
Antibody type
Polyclonal
Antigen
Afamin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INSNKDDRPKDLSLREGKFTDSENVCQERDADPDT
FFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNC
CNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHF
QNLGKDGLKYHYLIRLTKIAPQLSTEEL
Storage
-20C
Provider Type Product Number
- No reagents -