HPA017006

AFM antibody from Atlas Antibodies
ALB2, ALBA

Antibody data

Product number
HPA017006
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017006, RRID:AB_1844635
Product name
Anti-AFM
Provider product page
Atlas Antibodies - HPA017006
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INSNKDDRPKDLSLREGKFTDSENVCQERDADPDT
FFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNC
CNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHF
QNLGKDGLKYHYLIRLTKIAPQLSTEEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.