Antibody data
- Product number
- HPA017006
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017006, RRID:AB_1844635
- Product name
- Anti-AFM
- Provider product page
- Atlas Antibodies - HPA017006
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
INSNKDDRPKDLSLREGKFTDSENVCQERDADPDT
FFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNC
CNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHF
QNLGKDGLKYHYLIRLTKIAPQLSTEEL
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon using Anti-AFM antibody HPA017006.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-AFM antibody HPA017006.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver using Anti-AFM antibody HPA017006.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node using Anti-AFM antibody HPA017006.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-AFM antibody HPA017006 (A) shows similar protein distribution across tissues to independent antibody HPA052437 (B).
- Antibody #2 product nr
- HPA052437
- Antibody provider
- Atlas Antibodies
- Show more