ABIN503341

FBXW10 antibody from antibodies-online
C17orf1, C17orf1A, Fbw10, HREP, SM2SH2

Antibody data

Product number
ABIN503341
Provider
antibodies-online
Product name
anti-F-Box and WD Repeat Domain Containing 10 (FBXW10) antibody
Provider product page
antibodies-online - ABIN503341
Antibody type
Polyclonal
Antigen
The immunogen for anti-FBXW10 antibody: synthetic peptide directed towards the middle region of human FBXW10
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Antigen sequence
RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEEN
FLLSG SYDLSIRYWD
Vial size
50 µg
Provider Type Product Number
- No reagents -