HPA022836

FBXW10 antibody from Sigma-Aldrich
C17orf1, C17orf1A, Fbw10, HREP, SM2SH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022836, RRID:AB_1848472
Product name
Anti-FBXW10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022836
Antibody type
Polyclonal
Antigen
F-box/WD repeat-containing protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNGNCMKVLKANGRGDPVLSFFIQGNRMVVNTESN
VLMFQFEHIKWQYAVEKTKQKKNKEKEEEKEENSL
MEILSKCNIQVHS
Storage
-20C
Provider Type Product Number
- No reagents -