SAB2100796

FBXW10 antibody from Sigma-Aldrich
C17orf1, C17orf1A, Fbw10, HREP, SM2SH2
No application information provided.

Antibody data

Product number
SAB2100796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100796, RRID:AB_10598999
Product name
Anti-FBXW10 (ab1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100796
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_113644.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENE
HLLGAASNPEEPWRN
Storage
-20C
Provider Type Product Number
- No reagents -