Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502247 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Secretagogin, EF-Hand Calcium Binding Protein (SCGN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SCGN antibody: synthetic peptide directed towards the middle region of human SCGN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKT
GALEG PEVDGFVKDM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of secretagogin promoter activity.
Skovhus KV, Bergholdt R, Erichsen C, Sparre T, Nerup J, Karlsen AE, Pociot F
Scandinavian journal of immunology 2006 Dec;64(6):639-45
Scandinavian journal of immunology 2006 Dec;64(6):639-45
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting