Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90630 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90630, RRID:AB_2665612
- Product name
- Anti-SCGN
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRL
DLNDLARILALQENFLLQFKMDACSTEERKRDFEK
IFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISG
VDLDKFREILLRHCDVNKDGKIQKSELALCLGLK- Isotype
- IgG
- Antibody clone number
- CL0271
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Secretagogin is expressed in sensory CGRP neurons and in spinal cord of mouse and complements other calcium-binding proteins, with a note on rat and human.
Shi TJ, Xiang Q, Zhang MD, Tortoriello G, Hammarberg H, Mulder J, Fried K, Wagner L, Josephson A, Uhlén M, Harkany T, Hökfelt T
Molecular pain 2012 Oct 29;8:80
Molecular pain 2012 Oct 29;8:80
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human brain tissue lysate
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear immunoreactivity in the islets of Langerhans.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in the molecular layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong immunoreactivity in the neuroendocrine cells, as well as in the local ganglionic cells.