Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006641 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006641, RRID:AB_1079874
- Product name
- Anti-SCGN
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRL
DLNDLARILALQENFLLQFKMDACSTEERKRDFEK
IFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISG
VDLDKFREILLRHCDVNKDGKIQKSELALCLGLK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury
Distribution of secretagogin-containing neurons in the basal forebrain of mice, with special reference to the cholinergic corticopetal system.
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
The renaissance of Ca2+-binding proteins in the nervous system: secretagogin takes center stage
Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation
Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon.
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Secretagogin is a Ca2+-binding protein specifying subpopulations of telencephalic neurons.
Zhang M, Tortoriello G, Hsueh B, Tomer R, Ye L, Mitsios N, Borgius L, Grant G, Kiehn O, Watanabe M, Uhlen M, Mulder J, Deisseroth K, Harkany T, Hokfelt T
Proceedings of the National Academy of Sciences 2014 March;111(12)
Proceedings of the National Academy of Sciences 2014 March;111(12)
Distribution of secretagogin-containing neurons in the basal forebrain of mice, with special reference to the cholinergic corticopetal system.
Gyengesi E, Andrews ZB, Paxinos G, Zaborszky L
Brain research bulletin 2013 May;94:1-8
Brain research bulletin 2013 May;94:1-8
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
The renaissance of Ca2+-binding proteins in the nervous system: secretagogin takes center stage
Alpár A, Attems J, Mulder J, Hökfelt T, Harkany T
Cellular Signalling 2012 February;24(2):378-387
Cellular Signalling 2012 February;24(2):378-387
Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation
Attems J, Alpar A, Spence L, McParland S, Heikenwalder M, Uhlen M, Tanila H, Hokfelt T, Harkany T
Proceedings of the National Academy of Sciences 2012 April;109(16):6259-6264
Proceedings of the National Academy of Sciences 2012 April;109(16):6259-6264
Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon.
Mulder J, Spence L, Tortoriello G, Dinieri JA, Uhlén M, Shui B, Kotlikoff MI, Yanagawa Y, Aujard F, Hökfelt T, Hurd YL, Harkany T
The European journal of neuroscience 2010 Jun;31(12):2166-77
The European journal of neuroscience 2010 Jun;31(12):2166-77
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Secretagogin is a Ca2+-binding protein specifying subpopulations of telencephalic neurons.
Mulder J, Zilberter M, Spence L, Tortoriello G, Uhlén M, Yanagawa Y, Aujard F, Hökfelt T, Harkany T
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 29;106(52):22492-7
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 29;106(52):22492-7
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hypothalamus shows selective positivity in the paraventricular nucleus.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong positivity in subsets of neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse septohippocampal nucleus shows labeling of neuronal cell bodies and processes.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows selective immunoreactivity in fasciola cinerera.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong immunoreactivity in the molecular layer neurons.
- Sample type
- HUMAN