HPA006641

SCGN antibody from Sigma-Aldrich
CALBL, DJ501N12.8, SECRET, SEGN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006641
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006641, RRID:AB_1079874
Product name
Anti-SCGN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006641
Antibody type
Polyclonal
Antigen
Secretagogin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRL
DLNDLARILALQENFLLQFKMDACSTEERKRDFEK
IFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISG
VDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Storage
-20C
Provider Type Product Number
- No reagents -