HPA021881

PRPSAP2 antibody from Sigma-Aldrich
PAP41
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021881
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021881, RRID:AB_1855782
Product name
Anti-PRPSAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021881
Antibody type
Polyclonal
Antigen
Phosphoribosyl pyrophosphate synthetase-associated protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTPPELETKMNITKGGLVLFSANSNSSCMELSKKI
AERLGVEMGKVQVYQEPNRETRVQIQES
Storage
-20C
Provider Type Product Number
- No reagents -