HPA023117

EIF3H antibody from Atlas Antibodies
eIF3-gamma, eIF3-p40, eIF3h, EIF3S3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023117
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023117, RRID:AB_1848076
Product name
Anti-EIF3H
Provider product page
Atlas Antibodies - HPA023117
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKL
FKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLG
KLFMAQALQEYNN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -