HPA023553

EIF3H antibody from Sigma-Aldrich
eIF3-gamma, eIF3-p40, eIF3h, EIF3S3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023553
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023553, RRID:AB_1848077
Product name
Anti-EIF3H antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023553
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 3 subunit H recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVAD
KHELLSLASSNHLGKNLQLLMDRVDEMSQDI
Storage
-20C
Provider Type Product Number
- No reagents -