Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021868 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ROR2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAY
GAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSG
SGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLG- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Targeting the ROR1 and ROR2 receptors in epithelial ovarian cancer inhibits cell migration and invasion
Wnt5a and Ror2 expression associate with the disease progress of primary thyroid lymphoma
Novel domains of expression for orphan receptor tyrosine kinase Ror2 in the human and mouse reproductive system
Henry C, Llamosas E, Knipprath-Meszaros A, Schoetzau A, Obermann E, Fuenfschilling M, Caduff R, Fink D, Hacker N, Ward R, Heinzelmann-Schwarz V, Ford C
Oncotarget 2015;6(37):40310-40326
Oncotarget 2015;6(37):40310-40326
Wnt5a and Ror2 expression associate with the disease progress of primary thyroid lymphoma
Wang L, Yang D, Wang Y, Li X, Gao H, Lv J, Wang L, Xin S
Tumor Biology 2015;37(5):6085-6090
Tumor Biology 2015;37(5):6085-6090
Novel domains of expression for orphan receptor tyrosine kinase Ror2 in the human and mouse reproductive system
Arora R, Altman E, Tran N, Laird D
Developmental Dynamics 2014;243(8):1037-1045
Developmental Dynamics 2014;243(8):1037-1045
No comments: Submit comment
No validations: Submit validation data