HPA021868

ROR2 antibody from Sigma-Aldrich
BDB, BDB1, NTRKR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021868
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021868, RRID:AB_1856406
Product name
Anti-ROR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021868
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase transmembrane receptor ROR2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAY
GAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSG
SGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLG
Storage
-20C
Provider Type Product Number
- No reagents -