Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006642 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006642, RRID:AB_1848194
- Product name
- Anti-EPB41L2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSY
TLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQR
QAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSV
SKVEMQPTELVSKEREEKVKETQEDKLEGGA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
A network of spectrin and plectin surrounds the actin cuffs of apical tubulobulbar complexes in the rat.
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
A network of spectrin and plectin surrounds the actin cuffs of apical tubulobulbar complexes in the rat.
Aristaeus de Asis M, Pires M, Lyon K, Vogl AW
Spermatogenesis 2013 Jul 1;3(3):e25733
Spermatogenesis 2013 Jul 1;3(3):e25733
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN