HPA005730

EPB41L2 antibody from MilliporeSigma / Merck KGaA
4.1-G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005730
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005730, RRID:AB_1848195
Product name
Anti-EPB41L2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005730
Antibody type
Polyclonal
Antigen
Band 41-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSSH
ETLNIVEEKKRAEVGKDERVITEEEVEEE
Storage
-20C
Provider Type Product Number
- No reagents -