HPA006642

EPB41L2 antibody from Sigma-Aldrich
4.1-G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006642, RRID:AB_1848194
Product name
Anti-EPB41L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006642
Antibody type
Polyclonal
Antigen
Band 41-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSY
TLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQR
QAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSV
SKVEMQPTELVSKEREEKVKETQEDKLEGGA
Storage
-20C
Provider Type Product Number
- No reagents -