HPA019690

TRIM54 antibody from Atlas Antibodies
MURF, MURF-3, RNF30
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019690
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019690, RRID:AB_1858306
Product name
Anti-TRIM54
Provider product page
Atlas Antibodies - HPA019690
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPG
YESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVA
PDGEEGSAGPEEERPDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -