HPA019690

TRIM54 antibody from Sigma-Aldrich
MURF, MURF-3, RNF30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019690
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019690, RRID:AB_1858306
Product name
Anti-TRIM54 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019690
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 54 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPG
YESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVA
PDGEEGSAGPEEERPDG
Storage
-20C
Provider Type Product Number
- No reagents -