Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000174-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000174-M01, RRID:AB_464229
- Product name
- AFP monoclonal antibody (M01), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AFP.
- Antigen sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFH
KDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLE
AVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTR
AALGV- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A single-step enzyme immunoassay capillary sensor composed of functional multilayer coatings for the diagnosis of marker proteins.
Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis.
Funano S, Sugahara M, Henares TG, Sueyoshi K, Endo T, Hisamoto H
The Analyst 2015 Mar 7;140(5):1459-65
The Analyst 2015 Mar 7;140(5):1459-65
Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis.
Ramón-Azcón J, Yasukawa T, Mizutani F
Biosensors & bioelectronics 2011 Oct 15;28(1):443-9
Biosensors & bioelectronics 2011 Oct 15;28(1):443-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AFP monoclonal antibody (M01), clone 1G7 Western Blot analysis of AFP expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody (M01), clone 1G7.Lane 1: AFP transfected lysate(69 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AFP is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AFP MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol