HPA010607

AFP antibody from Atlas Antibodies
FETA, HPAFP
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA010607
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010607, RRID:AB_1078141
Product name
Anti-AFP
Provider product page
Atlas Antibodies - HPA010607
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSG
CLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG
RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDR
ETFMNKFIYEIARRHPFLYAPTILLWAAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -