HPA010607

AFP antibody from Sigma-Aldrich
FETA, HPAFP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010607
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010607, RRID:AB_1078141
Product name
Anti-AFP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010607
Antibody type
Polyclonal
Antigen
alpha-Fetoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSG
CLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG
RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDR
ETFMNKFIYEIARRHPFLYAPTILLWAAR
Storage
-20C
Provider Type Product Number
- No reagents -