HPA023600

AFP antibody from Sigma-Aldrich
FETA, HPAFP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023600, RRID:AB_1844769
Product name
Anti-AFP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023600
Antibody type
Polyclonal
Antigen
Alpha-fetoprotein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRF
LGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVS
VILRVAKGYQELLEKCFQTENPLECQDKGEEELQK
YIQESQALAKRSCGLFQKLGEYYLQNAFLVA
Storage
-20C
Provider Type Product Number
- No reagents -