Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038221 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038221, RRID:AB_10673044
- Product name
- Anti-KCNN2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NIMYDMISDLNERSEDFEKRIVTLETKLETLIGSI
HALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAE
RS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Reduction of APOE accounts for neurobehavioral deficits in fetal alcohol spectrum disorders
Hwang H, Yamashita S, Matsumoto Y, Ito M, Edwards A, Sasaki J, Dutta D, Mohammad S, Yamashita C, Wetherill L, Schwantes-An T, Abreu M, Mahnke A, Mattson S, Foroud T, Miranda R, Chambers C, Torii M, Hashimoto-Torii K
Molecular Psychiatry 2024;29(11):3364-3380
Molecular Psychiatry 2024;29(11):3364-3380
No comments: Submit comment
No validations: Submit validation data