HPA020044

RAD21 antibody from Sigma-Aldrich
hHR21, KIAA0078, SCC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020044
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020044, RRID:AB_1856035
Product name
Anti-RAD21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020044
Antibody type
Polyclonal
Antigen
Double-strand-break repair protein rad21 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCL
TPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPRE
DQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNI
DESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQME
IPPVEL
Storage
-20C
Provider Type Product Number
- No reagents -