HPA002892

NPAS3 antibody from Sigma-Aldrich
bHLHe12, MOP6, PASD6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002892
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002892, RRID:AB_1079403
Product name
Anti-NPAS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002892
Antibody type
Polyclonal
Antigen
Neuronal PAS domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRG
LLSQGTAEDGASSASSSSQSETPEPVESTSPSLLT
TDNTLERSFFIRMKSTLTKRGVHIKSSGYKV
Storage
-20C
Provider Type Product Number
- No reagents -