HPA004055

GNPTG antibody from Sigma-Aldrich
C16orf27, c316G12.3, CAB56184, GNPTAG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004055, RRID:AB_1079006
Product name
Anti-GNPTG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004055
Antibody type
Polyclonal
Antigen
N-Acetylglucosamine-1-phosphotransferase subunit gamma precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHALLVYPTLPEALQRQWDQVEQDLADELITPQGH
EKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFE
TLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTE
TSNLEHLG
Storage
-20C
Provider Type Product Number
- No reagents -