HPA027863

NPY4R antibody from MilliporeSigma / Merck KGaA
PP1, PPYR1, Y4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027863
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027863, RRID:AB_10602819
Product name
Anti-PPYR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027863
Antibody type
Polyclonal
Antigen
pancreatic polypeptide receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSPRLSGRSN
Storage
-20C
Provider Type Product Number
- No reagents -