Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91092 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91092, RRID:AB_2665797
- Product name
- Anti-LAMB1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAEL
TNRTHRFLEKAKALKISGVIGPYRETVDSVERKVS
EIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEM
MAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNT
VKELAEQLEF- Isotype
- IgG
- Antibody clone number
- CL2970
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-111, Laminin-211, Laminin-411, Laminin-511, Laminin-521 and Laminin-332.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human placenta tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate immunoreactivity in basement membrane of trophoblast and in endothelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows positivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate positivity in basement membrane of exocrine glands.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of immunoreactivity in lymphoid cells (negative control).