HPA004056

LAMB1 antibody from Atlas Antibodies
CLM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004056
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004056, RRID:AB_1079226
Product name
Anti-LAMB1
Provider product page
Atlas Antibodies - HPA004056
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAEL
TNRTHRFLEKAKALKISGVIGPYRETVDSVERKVS
EIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEM
MAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNT
VKELAEQLEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -