HPA004132

LAMB1 antibody from Sigma-Aldrich
CLM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004132, RRID:AB_1079225
Product name
Anti-LAMB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004132
Antibody type
Polyclonal
Antigen
Laminin subunit beta-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQ
YTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGS
GDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCR
NIIFSISALLHQTGLACECDPQGSLSSVCDPNGG
Storage
-20C
Provider Type Product Number
- No reagents -