Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309905 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 1, Group H, Member 3 (NR1H3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALR
LQDKK LPPLLSEIWD- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phosphorylation of liver X receptor alpha selectively regulates target gene expression in macrophages.
Torra IP, Ismaili N, Feig JE, Xu CF, Cavasotto C, Pancratov R, Rogatsky I, Neubert TA, Fisher EA, Garabedian MJ
Molecular and cellular biology 2008 Apr;28(8):2626-36
Molecular and cellular biology 2008 Apr;28(8):2626-36
No comments: Submit comment
No validations: Submit validation data