HPA009656

ZNF174 antibody from Sigma-Aldrich
ZSCAN8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009656, RRID:AB_1080679
Product name
Anti-ZNF174 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009656
Antibody type
Polyclonal
Antigen
Zinc finger protein 174 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVM
EQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHR
ASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDF
QPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSP
LLQ
Storage
-20C
Provider Type Product Number
- No reagents -