ABIN486879

GTF3C2 antibody from antibodies-online
KIAA0011, TFIIIC110

Antibody data

Product number
ABIN486879
Provider
antibodies-online
Product name
anti-General Transcription Factor IIIC, Polypeptide 2, beta 110kDa (GTF3C2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486879
Antibody type
Polyclonal
Antigen
The immunogen for anti-GTF3C2 antibody: synthetic peptide directed towards the middle region of human GTF3C2
Description
Affinity Purified
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTE
TVNHH YLLFQDTDLG
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -