Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486879 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIIC, Polypeptide 2, beta 110kDa (GTF3C2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF3C2 antibody: synthetic peptide directed towards the middle region of human GTF3C2
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTE
TVNHH YLLFQDTDLG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification, molecular cloning, and characterization of the sixth subunit of human transcription factor TFIIIC.
Dumay-Odelot H, Marck C, Durrieu-Gaillard S, Lefebvre O, Jourdain S, Prochazkova M, Pflieger A, Teichmann M
The Journal of biological chemistry 2007 Jun 8;282(23):17179-89
The Journal of biological chemistry 2007 Jun 8;282(23):17179-89
No comments: Submit comment
No validations: Submit validation data